PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK40204.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 169aa    MW: 18812.8 Da    PI: 4.7697
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK40204.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.52.5e-123289562
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                ++ +r+ +NRe+ArrsR RK++ ++ L+  + +L++ N++    l   ++++ k ++e
  KFK40204.1 32 RKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSNDNRQILTSLTVTSQLYMKIQAE 89
                57899*********************************99887777777777666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-162892IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1973093IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-93074No hitNo description
SuperFamilySSF579598.84E-123283No hitNo description
PfamPF001701.4E-93282IPR004827Basic-leucine zipper domain
CDDcd147021.59E-213384No hitNo description
PROSITE patternPS0003603550IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MASSSSTYRS SSSSDGCNNN NPSESTVVVD ERKRKRMLSN RESARRSRMR KQKHVDDLTA  60
QINQLSNDNR QILTSLTVTS QLYMKIQAEN SVLTAQMSEL TTRLESLNEI VELVTINGSG  120
FGDQIDGCGF DDRTVGIDGY YDDMMSGVTP WGGSVYTNQP IMANDINMY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13152RKRKRMLSNRESARRSRMRKQK
24451RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00267DAPTransfer from AT2G18160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010413979.11e-97PREDICTED: ocs element-binding factor 1-like
RefseqXP_010467622.11e-97PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP83e-27BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A087HDK21e-122A0A087HDK2_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.3__3423__AT2G18162.13e-95(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.15e-93basic leucine-zipper 2